PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016468549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 336aa    MW: 36140.3 Da    PI: 7.663
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016468549.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1298142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
   XP_016468549.1  98 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 142
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93991147IPR017930Myb domain
SuperFamilySSF466897.25E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1994146IPR006447Myb domain, plants
SMARTSM007178.0E-1195145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1195141IPR009057Homeodomain-like
PfamPF002491.1E-1098142IPR001005SANT/Myb domain
CDDcd001672.65E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MTRRCSHCST NGHNSRTCPN RGVKLFGVRL TDGLIRKSAS MGNLTHFASS SGPLNGAVHD  60
SPGDTPDHPA VGGSADGYAS EDFVAGSSSS RERKKGVPWT EEEHRMFLLG LQKLGKGDWR  120
GIARNYVISR TPTQVASHAQ KYFIRQSNMS RRKRRSSLFD IVADESGDTP MVSRDFLADD  180
PLQAEIQSNN PLPPTPSVDE ECESMGSAAS ANSNDGELSL PKPESSQYPR PLVYPAYVAP  240
FFPMPYPCWP GYTAELAKAE THEVLKPTAV HSKSPINVDE LVGMSKLSLG ESIGDAKPSS  300
LSLKLVEGSS RQSAFHANPS SGSSGMNSSH SPIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankS747530.0S74753.1 mybSt1=Myb-related transcriptional activator [Solanum tuberosum=potatoes, leaf, mRNA, 1465 nt].
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016468549.10.0PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLA0A0V0IA260.0A0A0V0IA26_SOLCH; Putative MYBST1 protein-like
TrEMBLM1CHD30.0M1CHD3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000674890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-131MYB_related family protein